YTHD1 antibody

Details for Product No. ABIN4890013, Supplier: Log in to see
Antigen
Reactivity
Human
Host
Rabbit
Clonality
Polyclonal
Application
Western Blotting (WB)
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to YTHDF1(YTH domain family, member 1) The peptide sequence was selected from the middle region of YTHDF1. Peptide sequence QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA.
Purification Immunogen affinity purified
Antigen
Background Gene Symbol: YTHDF1
Molecular Weight Theoretical MW: 61 kDa
Gene ID 54915
UniProt Q9BYJ9
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against YTHDF1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-YTHD1 antibody (ABIN4890013) Western Blot: YTHD1 Antibody [NBP1-52865] - Reccomended Titration: 0.2 - 1 ug/ml Posi...
Western Blotting (WB) image for anti-YTHD1 antibody (ABIN4890013) Western Blot: YTHD1 Antibody [NBP1-52865] - Sample Tissue: Human Ovary Tumor Antibody...
Did you look for something else?