Transportin 2 (TNPO2) (C-Term) antibody

Details for Product No. ABIN4890025, Supplier: Log in to see
Antigen
  • TNPO2
  • IPO3
  • KPNB2B
  • TRN2
  • ik:tdsubc_2a7
  • tdsubc_2a7
  • wu:fb01c02
  • wu:fe01f03
  • wu:fe16e12
  • xx:tdsubc_2a7
  • zgc:101009
  • 1110034O24Rik
  • AA414969
  • AI464345
  • AI852433
  • Knpb2b
  • Kpnb2b
  • transportin 2
  • transportin 2 L homeolog
  • transportin 2 (importin 3, karyopherin beta 2b)
  • TNPO2
  • tnpo2.L
  • Tnpo2
  • tnpo2
Epitope
C-Term
2
2
1
1
Reactivity
Human
17
10
10
2
2
2
2
2
2
Host
Rabbit
15
2
Clonality
Polyclonal
Application
Western Blotting (WB)
16
8
5
4
3
3
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to TNPO2(transportin 2 (importin 3, karyopherin beta 2b)) The peptide sequence was selected from the C terminal of TNPO2. Peptide sequence LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA.
Purification Immunogen affinity purified
Antigen
Alternative Name TNPO2 (TNPO2 Antibody Abstract)
Background Gene Symbol: TNPO2
Molecular Weight Theoretical MW: 100 kDa
Gene ID 30000
UniProt Q6IN77
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against TNPO2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Transportin 2 (TNPO2) (C-Term) antibody (ABIN4890025) Western Blot: TNPO2 Antibody [NBP1-52896] - Jurkat cell lysate, concentration 0.2-1 u...
Did you look for something else?