MBD3 antibody (Methyl-CpG Binding Domain Protein 3) (N-Term)

Details for Product anti-MBD3 Antibody No. ABIN4890031, Supplier: Log in to see
Antigen
  • xmbd3
  • MGC69548
  • MBD3
  • DKFZp459N1635
  • AI181826
  • AU019209
  • methyl-CpG binding domain protein 3 S homeolog
  • methyl-CpG binding domain protein 3
  • mbd3.S
  • mbd3
  • MBD3
  • Mbd3
Alternatives
anti-Human MBD3 antibody for Western Blotting
Epitope
N-Term
17
16
13
7
6
4
4
2
2
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Human
115
33
13
6
4
4
4
4
4
3
3
3
2
1
1
1
Host
Rabbit
76
37
2
Clonality
Polyclonal
Conjugate
This MBD3 antibody is un-conjugated
4
4
4
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
103
46
28
17
9
8
5
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to MBD3(methyl-CpG binding domain protein 3) The peptide sequence was selected from the N terminal of MBD3. Peptide sequence SKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSN.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others MBD3 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name MBD3 (MBD3 Antibody Abstract)
Background Gene Symbol: MBD3
Molecular Weight Theoretical MW: 33 kDa
Gene ID 53615
UniProt O95983
Pathways Chromatin Binding
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against MBD3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Methyl-CpG Binding Domain Protein 3 (MBD3) (N-Term) antibody (ABIN4890031) Western Blot: MBD3 Antibody [NBP1-52905] - Transfected 293T cell lysate, concentratio...
Did you look for something else?