Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2CA) (Isoform gamma) antibody

Details for Product No. ABIN4890039, Supplier: Log in to see
  • B56G
  • PR61G
  • 2610043M05Rik
  • 2700063L20Rik
  • AI060890
  • AW545884
  • C85228
  • D12Bwg0916e
  • mKIAA0044
  • b56g
  • ppp2r5c
  • si:dkey-241l7.9
  • protein phosphatase 2 regulatory subunit B'gamma
  • protein phosphatase 2, regulatory subunit B', gamma
  • protein phosphatase 2 regulatory subunit B', gamma
  • protein phosphatase 2, regulatory subunit B', gamma b
  • protein phosphatase 2, regulatory subunit B', gamma a
  • PPP2R5C
  • Ppp2r5c
  • ppp2r5c
  • ppp2r5c.L
  • ppp2r5cb
  • ppp2r5ca
anti-Human Protein Phosphatase 2, Regulatory Subunit B', gamma antibody for Western Blotting
Isoform gamma
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to PPP2R5C(protein phosphatase 2, regulatory subunit B', gamma isoform) The peptide sequence was selected from the middle region of PPP2R5C (NP_848703). Peptide sequence RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIY
Specificity This product is specific to the gamma isoform.
Purification Immunogen affinity purified
Alternative Name PPP2R5C (PPP2CA Antibody Abstract)
Background Gene Symbol: PPP2R5C
Molecular Weight Theoretical MW: 45 kDa
Gene ID 5527
UniProt Q96B13
Pathways PI3K-Akt Signaling
Application Notes Western Blot 0.2-1 μg/mLThe observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2CA) (Isoform gamma) antibody (ABIN4890039) Western Blot: PPP2R5C Antibody [NBP1-52915] - HepG2 cell lysate, concentration 0.2-1 ...
Did you look for something else?