PNMA3 antibody (Paraneoplastic Antigen MA3) (N-Term)

Details for Product anti-PNMA3 Antibody No. ABIN4890046, Supplier: Log in to see
Antigen
  • MA3
  • MA5
  • RGD1563752
  • PNMA family member 3
  • paraneoplastic antigen MA3
  • paraneoplastic Ma antigen 3
  • PNMA3
  • Pnma3
Epitope
N-Term
10
9
7
3
2
2
1
1
Reactivity
Human
36
2
1
1
Host
Rabbit
24
12
Clonality
Polyclonal
Conjugate
This PNMA3 antibody is un-conjugated
2
2
2
2
2
2
Application
Western Blotting (WB)
35
14
8
4
3
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to PNMA3(paraneoplastic antigen MA3) The peptide sequence was selected from the N terminal of PNMA3. Peptide sequence QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others PNMA3 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name PNMA3 (PNMA3 Antibody Abstract)
Background Gene Symbol: PNMA3
Molecular Weight Theoretical MW: 52 kDa
Gene ID 29944
UniProt Q9UL41
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against PNMA3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Paraneoplastic Antigen MA3 (PNMA3) (N-Term) antibody (ABIN4890046) Western Blot: PNMA3 Antibody [NBP1-52929] - Titration: 0.2-1 ug/ml, Positive Control:...
Did you look for something else?