Paraneoplastic Antigen MA1 (PNMA1) antibody

Details for Product No. ABIN4890052, Supplier: Log in to see
Antigen
  • PNMA1
  • 5730402C15Rik
  • MA1
  • PNMA family member 1
  • paraneoplastic antigen MA1
  • paraneoplastic Ma antigen 1
  • PNMA1
  • Pnma1
Reactivity
Human
49
25
23
3
2
2
2
2
1
Host
Rabbit
41
8
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
31
17
13
10
8
6
2
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to PNMA1(paraneoplastic antigen MA1) The peptide sequence was selected from the middle region of PNMA1. Peptide sequence KSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIR.
Purification Immunogen affinity purified
Antigen
Alternative Name PNMA1 (PNMA1 Antibody Abstract)
Background Gene Symbol: PNMA1
Molecular Weight Theoretical MW: 40 kDa
Gene ID 9240
UniProt Q8ND90
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against PNMA1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Paraneoplastic Antigen MA1 (PNMA1) antibody (ABIN4890052) Western Blot: PNMA1 Antibody [NBP1-52935] - Jurkat cell lysate, concentration 0.2-1 u...
Did you look for something else?