STRAP antibody (Serine/threonine Kinase Receptor Associated Protein) (N-Term)

Details for Product anti-STRAP Antibody No. ABIN4890060, Supplier: Log in to see
  • MAWD
  • PT-WD
  • zgc:56677
  • zgc:77604
  • mawd
  • pt-wd
  • unrip
  • AW557906
  • C78091
  • C79202
  • Unrip
  • serine/threonine kinase receptor associated protein
  • serine/threonine kinase receptor associated protein L homeolog
  • serine/threonine kinase receptor associated protein S homeolog
  • strap
  • strap.L
  • strap.S
  • Strap
This STRAP antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to STRAP(serine/threonine kinase receptor associated protein) The peptide sequence was selected from the N terminal of STRAP (NP_009109). Peptide sequence HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others STRAP products on genomics-online (e.g. as negative or positive controls)
Alternative Name STRAP (STRAP Antibody Abstract)
Background Gene Symbol: STRAP
Molecular Weight Theoretical MW: 38 kDa
Gene ID 11171
UniProt Q9Y3F4
Application Notes Western Blot 0.5 μg/mL, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 μg/mLThe observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Did you look for something else?