Tribbles Homolog 2 (Drosophila) (TRIB2) antibody

Details for Product No. ABIN4890061, Supplier: Log in to see
Antigen
  • TRIB2
  • Trb2
  • Xtrbl
  • gs3955
  • c5fw
  • trb2
  • xtrb2
  • TRB2
  • C5FW
  • GS3955
  • TRB-2
  • AW319517
  • RGD1564451
  • tribbles pseudokinase 2
  • tribbles pseudokinase 2 S homeolog
  • TRIB2
  • trib2
  • trib2.S
  • Trib2
Reactivity
Human
77
36
27
6
4
4
4
3
3
3
3
2
2
1
1
Host
Rabbit
58
13
6
Clonality
Polyclonal
Conjugate
Un-conjugated
4
4
4
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
53
37
20
17
13
6
5
2
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to TRIB2(tribbles homolog 2 (Drosophila)) The peptide sequence was selected from the middle region of TRIB2. Peptide sequence YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE.
Purification Immunogen affinity purified
Antigen
Alternative Name TRIB2 (TRIB2 Antibody Abstract)
Background Gene Symbol: TRIB2
Molecular Weight Theoretical MW: 39 kDa
Gene ID 28951
UniProt Q92519
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against TRIB2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Tribbles Homolog 2 (Drosophila) (TRIB2) antibody (ABIN4890061) Western Blot: TRIB2 Antibody [NBP1-52952] - Titration: 0.2-1 ug/ml, Positive Control:...
Did you look for something else?