CHFR antibody (Checkpoint with Forkhead and Ring Finger Domains) (N-Term)

Details for Product anti-CHFR Antibody No. ABIN4890063
Antigen
  • RNF116
  • RNF196
  • CHFR
  • rnf116
  • rnf196
  • 5730484M20Rik
  • C230082M18
  • checkpoint with forkhead and ring finger domains
  • checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase
  • checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase L homeolog
  • CHFR
  • chfr
  • Chfr
  • chfr.L
Epitope
N-Term
19
8
7
4
4
2
2
2
1
1
1
Reactivity
Human
80
26
23
3
3
3
2
2
2
2
2
1
1
1
Host
Rabbit
59
16
5
Clonality
Polyclonal
Conjugate
This CHFR antibody is un-conjugated
6
4
4
3
3
3
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
49
47
26
6
1
1
1
1
Options
Immunogen Synthetic peptides corresponding to CHFR(checkpoint with forkhead and ring finger domains) The peptide sequence was selected from the N terminal of CHFR. Peptide sequence REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others CHFR products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name CHFR (CHFR Antibody Abstract)
Background Gene Symbol: CHFR
Gene ID 55743
UniProt Q96EP1
Application Notes Western Blot 0.2-1 μg/mL, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 μg/mLThis is a rabbit polyclonal antibody against CHFR and was validated on Western blot.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Checkpoint with Forkhead and Ring Finger Domains (CHFR) (N-Term) antibody (ABIN4890063) Immunohistochemistry-Paraffin: CHFR Antibody [NBP1-52955] - Human breast tissue at an...
Western Blotting (WB) image for anti-Checkpoint with Forkhead and Ring Finger Domains (CHFR) (N-Term) antibody (ABIN4890063) Western Blot: CHFR Antibody [NBP1-52955] - Titration: 0.2-1 ug/ml, Positive Control: ...
Did you look for something else?