m1ip1 antibody (Mid1-Interacting Protein 1)

Details for Product anti-m1ip1 Antibody No. ABIN4890069, Supplier: Log in to see
  • G12-like
  • MIG12
  • S14R
  • STRAIT11499
  • 3110038L01Rik
  • Mig12
  • slap
  • mig12
  • thrspl
  • MGC80850
  • zgc:73223
  • MID1 interacting protein 1
  • Mid1-interacting protein 1
  • Mid1 interacting protein 1 (gastrulation specific G12-like (zebrafish))
  • MID1 interacting protein 1 S homeolog
  • MID1 interacting protein 1b
  • MID1IP1
  • m1ip1
  • Mid1ip1
  • mid1ip1.S
  • mid1ip1b
This m1ip1 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to SLA(Src-like-adaptor) The peptide sequence was selected from the middle region of SLA. Peptide sequence PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGG.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others m1ip1 products on genomics-online (e.g. as negative or positive controls)
Alternative Name Slap
Background Gene Symbol: SLA
Gene ID 6503
UniProt Q5TZW1
Application Notes Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against SLA and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mid1-Interacting Protein 1 (m1ip1) antibody (ABIN4890069) Immunohistochemistry-Paraffin: Slap Antibody [NBP1-52966] - Human Spleen cell tissue,...
Western Blotting (WB) image for anti-Mid1-Interacting Protein 1 (m1ip1) antibody (ABIN4890069) Western Blot: Slap Antibody [NBP1-52966] - OVCAR-3 cell lysate, Antibody Titration: 0...
Did you look for something else?