PDE7B antibody (phosphodiesterase 7B)

Details for Product anti-PDE7B Antibody No. ABIN4890075, Supplier: Log in to see
  • PDE7B
  • ba472e5.1
  • bA472E5.1
  • phosphodiesterase 7B
  • PDE7B
  • pde7b
  • Pde7b
anti-Human PDE7B antibody for Immunoprecipitation
This PDE7B antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to PDE7B(phosphodiesterase 7B) The peptide sequence was selected from the middle region of PDE7B. Peptide sequence IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others PDE7B products on genomics-online (e.g. as negative or positive controls)
Alternative Name PDE7B (PDE7B Antibody Abstract)
Background Gene Symbol: PDE7B
Molecular Weight Theoretical MW: 52 kDa
Gene ID 27115
UniProt Q9NP56
Pathways cAMP Metabolic Process
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against PDE7B and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-phosphodiesterase 7B (PDE7B) antibody (ABIN4890075) Western Blot: PDE7B Antibody [NBP1-52979] - MCF-7 whole cell lysates, concentration 0...
Did you look for something else?