RNF20 antibody (Ring Finger Protein 20) (N-Term)

Details for Product anti-RNF20 Antibody No. ABIN4890078, Supplier: Log in to see
Antigen
  • 4833430L21Rik
  • AW540162
  • C79397
  • mKIAA4116
  • BRE1
  • BRE1A
  • hBRE1
  • ring finger protein 20
  • RNF20
  • Rnf20
Epitope
N-Term
13
9
7
5
5
3
2
2
2
2
1
1
1
Reactivity
Human
89
41
28
6
5
5
4
4
2
2
2
1
Host
Rabbit
77
12
Clonality
Polyclonal
Conjugate
This RNF20 antibody is un-conjugated
4
4
4
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
69
40
17
13
13
10
8
4
3
3
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to RNF20(ring finger protein 20) The peptide sequence was selected from the N terminal of RNF20. Peptide sequence LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others RNF20 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name RNF20 (RNF20 Antibody Abstract)
Background Gene Symbol: RNF20
Gene ID 56254
UniProt Q5VTR2
Application Notes Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against RNF20 and was validated on Western blot.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Ring Finger Protein 20 (RNF20) (N-Term) antibody (ABIN4890078) Western Blot: RNF20 Antibody [NBP1-52985] - HepG2 cell lysate, concentration 0.2-1 ug...
Did you look for something else?