MSL2 antibody (Male-Specific Lethal 2 Homolog (Drosophila)) (N-Term)

Details for Product anti-MSL2 Antibody No. ABIN4890080, Supplier: Log in to see
  • MSL-2
  • MSL2L1
  • RNF184
  • E130103E02Rik
  • Msl2l1
  • Rnf184
  • RGD1310355
  • MSL complex subunit 2
  • male-specific lethal 2 homolog (Drosophila)
  • MSL2
  • Msl2
This MSL2 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to MSL2L1(male-specific lethal 2-like 1 (Drosophila)) The peptide sequence was selected from the N terminal of MSL2L1. Peptide sequence NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others MSL2 products on genomics-online (e.g. as negative or positive controls)
Alternative Name MSL2L1 (MSL2 Antibody Abstract)
Background Gene Symbol: MSL2
Gene ID 55167
UniProt Q9HCI7
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against MSL2L1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Male-Specific Lethal 2 Homolog (Drosophila) (MSL2) (N-Term) antibody (ABIN4890080) Western Blot: MSL2L1 Antibody [NBP1-52987] - Hela cell lysate, concentration 0.2-1 ug...
Did you look for something else?