PIN4 antibody (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein)

Details for Product anti-PIN4 Antibody No. ABIN4890081, Supplier: Log in to see
Antigen
  • 2410002I22Rik
  • EPVH
  • Par14
  • PAR14
  • PAR17
  • zgc:110008
  • peptidylprolyl cis/trans isomerase, NIMA-interacting 4
  • protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)
  • protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)
  • PIN4
  • Pin4
  • pin4
Reactivity
Human
42
6
6
1
1
1
1
1
1
1
Host
Rabbit
37
5
Clonality
Polyclonal
Conjugate
This PIN4 antibody is un-conjugated
4
4
3
2
2
2
Application
Western Blotting (WB)
38
22
8
2
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to PIN4(protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)) The peptide sequence was selected from the middle region of PIN4. Peptide sequence LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTK
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others PIN4 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name PIN4 (PIN4 Antibody Abstract)
Background Gene Symbol: PIN4
Molecular Weight Theoretical MW: 16 kDa
Gene ID 5303
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against PIN4 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4) antibody (ABIN4890081) Western Blot: PIN4 Antibody [NBP1-52995] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Did you look for something else?