RSF1 antibody (Remodeling and Spacing Factor 1)

Details for Product anti-RSF1 Antibody No. ABIN4890083, Supplier: Log in to see
  • Rsf-1
  • CG5655
  • Dmel\\CG5655
  • ROX21
  • RSF1
  • Rox21
  • rox21
  • hbxap
  • RSF-1
  • XAP8
  • p325
  • 4832420A03Rik
  • C030033M12Rik
  • Gm164
  • Hbxap
  • remodeling and spacing factor 1
  • Repressor splicing factor 1
  • remodeling and spacing factor 1 S homeolog
  • RSF1
  • Rsf1
  • rsf1.S
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to RSF1(remodeling and spacing factor 1) The peptide sequence was selected from the middle region of RSF1. Peptide sequence QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others RSF1 products on genomics-online (e.g. as negative or positive controls)
Alternative Name RSF1 (RSF1 Antibody Abstract)
Background Gene Symbol: RSF1
Molecular Weight Theoretical MW: 164 kDa
Gene ID 51773
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against RSF1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Remodeling and Spacing Factor 1 (RSF1) antibody (ABIN4890083) Western Blot: RSF1 Antibody [NBP1-52999] - Human Lung lysate, concentration 0.2-1 ug/ml.
Did you look for something else?