Histone H2AY/macroH2A.1 (N-Term) antibody

Details for Product No. ABIN4890087, Supplier: Log in to see
Antigen
Epitope
N-Term
1
1
Reactivity
Human
6
1
1
1
Host
Rabbit
4
2
Clonality
Polyclonal
Application
Western Blotting (WB)
5
2
2
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to H2AFY(H2A histone family, member Y) The peptide sequence was selected from the N terminal of H2AFY. Peptide sequence HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV.
Purification Immunogen affinity purified
Antigen
Background Gene Symbol: H2AFY
Molecular Weight Theoretical MW: 39 kDa
Gene ID 9555
UniProt O75367
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against H2AFY and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Histone H2AY/macroH2A.1 (N-Term) antibody (ABIN4890087) Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003] - MCF-7 whole cell lysate...
Western Blotting (WB) image for anti-Histone H2AY/macroH2A.1 (N-Term) antibody (ABIN4890087) Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003] - MCF7, Antibody Dilution...
Did you look for something else?