TTC5 antibody (Tetratricopeptide Repeat Domain 5) (C-Term)

Details for Product anti-TTC5 Antibody No. ABIN4890088, Supplier: Log in to see
  • TTC5
  • ttc5
  • wu:fi33h05
  • wu:fy81e07
  • zgc:112059
  • Strap
  • 5930437N14
  • AW743060
  • tetratricopeptide repeat domain 5 L homeolog
  • tetratricopeptide repeat domain 5
  • ttc5.L
  • TTC5
  • ttc5
  • Ttc5
anti-Human TTC5 antibody for Western Blotting
This TTC5 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to TTC5(tetratricopeptide repeat domain 5) The peptide sequence was selected from the C terminal of TTC5. Peptide sequence GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others TTC5 products on genomics-online (e.g. as negative or positive controls)
Alternative Name TTC5 (TTC5 Antibody Abstract)
Background Gene Symbol: TTC5
Gene ID 91875
UniProt Q8N0Z6
Pathways Chromatin Binding
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against TTC5 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Tetratricopeptide Repeat Domain 5 (TTC5) (C-Term) antibody (ABIN4890088) Western Blot: TTC5 Antibody [NBP1-53012] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Did you look for something else?