IMPDH2 antibody (IMP (Inosine 5'-Monophosphate) Dehydrogenase 2) (C-Term)

Details for Product anti-IMPDH2 Antibody No. ABIN4890095, Supplier: Log in to see
Antigen
  • imp2
  • impd2
  • impdh-ii
  • impdh2
  • IMPD2
  • IMPDH-II
  • IMPD 2
  • IMPDH 2
  • cb635
  • wu:fb64g02
  • wu:fc43f09
  • IMPD
  • inosine monophosphate dehydrogenase 2
  • IMP (inosine 5'-monophosphate) dehydrogenase 2
  • inosine 5'-phosphate dehydrogenase 2
  • IMPDH2
  • impdh2.S
  • impdh2
  • Impdh2
Alternatives
anti-Human IMPDH2 antibody for ELISA
Epitope
C-Term
10
8
5
5
4
2
2
2
1
1
1
1
1
Reactivity
Human
101
32
25
8
8
6
6
5
4
4
4
4
4
3
2
2
2
2
2
1
1
Host
Rabbit
74
18
9
Clonality
Polyclonal
Conjugate
This IMPDH2 antibody is un-conjugated
6
6
6
1
1
1
Application
Western Blotting (WB)
89
51
36
14
9
8
8
5
2
2
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to IMPDH2(IMP (inosine monophosphate) dehydrogenase 2) The peptide sequence was selected from the C terminal of IMPDH2 (NP_000875). Peptide sequence SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others IMPDH2 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name IMP Dehydrogenase 2/IMPDH2 (IMPDH2 Antibody Abstract)
Background Gene Symbol: IMPDH2
Molecular Weight Theoretical MW: 56 kDa
Gene ID 3615
UniProt P12268
Pathways Ribonucleoside Biosynthetic Process
Application Notes Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against IMPDH2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2) (C-Term) antibody (ABIN4890095) Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-53028] - HepG2 cell lysate, c...
Did you look for something else?