CEP55 antibody (Centrosomal Protein 55kDa) (N-Term)

Details for Product anti-CEP55 Antibody No. ABIN4890101, Supplier: Log in to see
  • C10orf3
  • CT111
  • URCC6
  • RGD1305340
  • 1200008O12Rik
  • 2700032M20Rik
  • centrosomal protein 55
  • CEP55
  • Cep55
This CEP55 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to CEP55(centrosomal protein 55kDa) The peptide sequence was selected from the N terminal of CEP55. Peptide sequence MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others CEP55 products on genomics-online (e.g. as negative or positive controls)
Alternative Name CEP55 (CEP55 Antibody Abstract)
Background Gene Symbol: CEP55
Gene ID 55165
UniProt Q53EZ4
Application Notes Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against CEP55 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Centrosomal Protein 55kDa (CEP55) (N-Term) antibody (ABIN4890101) Western Blot: CEP55 Antibody [NBP1-53040] - 721_B cell lysate, concentration 0.2-1 ug...
Did you look for something else?