IVNS1ABP antibody (Influenza Virus NS1A Binding Protein) (N-Term)

Details for Product anti-IVNS1ABP Antibody No. ABIN4890103, Supplier: Log in to see
  • FLARA3
  • HSPC068
  • KLHL39
  • ND1
  • NS-1
  • NS1-BP
  • NS1BP
  • 1190004M08Rik
  • 1700126I16Rik
  • AA960440
  • Nd1-L
  • Nd1-S
  • mKIAA0850
  • cb1052
  • fj23g11
  • ivns1abp
  • wu:fj23g11
  • influenza virus NS1A binding protein
  • influenza virus NS1A binding protein L homeolog
  • influenza virus NS1A binding protein a
  • Ivns1abp
  • ivns1abp.L
  • ivns1abpa
anti-Human IVNS1ABP antibody for Immunohistochemistry (Paraffin-embedded Sections)
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to IVNS1ABP (influenza virus NS1A binding protein) The peptide sequence was selected from the N terminal of IVNS1ABP. Peptide sequence RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others IVNS1ABP products on genomics-online (e.g. as negative or positive controls)
Alternative Name NS1-BP (IVNS1ABP Antibody Abstract)
Background Gene Symbol: IVNS1ABP
Molecular Weight Theoretical MW: 72 kDa
Gene ID 10625
UniProt Q9Y6Y0, Q920Q8
Pathways Negative Regulation of intrinsic apoptotic Signaling
Application Notes Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against IVNS1ABP and was validated on Western Blot and immunohistochemistry-P The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Influenza Virus NS1A Binding Protein (IVNS1ABP) (N-Term) antibody (ABIN4890103) Western Blot: NS1-BP Antibody [NBP1-53044] - K562 cell lysate, Antibody Titration: 0....
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Influenza Virus NS1A Binding Protein (IVNS1ABP) (N-Term) antibody (ABIN4890103) Immunohistochemistry-Paraffin: NS1-BP Antibody [NBP1-53044] - Human Liver Tissue, ant...
Did you look for something else?