NSUN2 antibody (NOP2/Sun Domain Family, Member 2) (C-Term)

Details for Product anti-NSUN2 Antibody No. ABIN4890108, Supplier: Log in to see
  • D13Wsu123e
  • Misu
  • MISU
  • MRT5
  • SAKI
  • TRM4
  • RGD1311954
  • NOL1/NOP2/Sun domain family member 2
  • NOP2/Sun RNA methyltransferase family member 2
  • NOP2/Sun RNA methyltransferase family, member 2
  • NOP2/Sun RNA methyltransferase family member 2 S homeolog
  • Nsun2
  • NSUN2
  • nsun2.S
This NSUN2 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to NSUN2(NOL1/NOP2/Sun domain family, member 2) The peptide sequence was selected from the C terminal of NSUN2. Peptide sequence FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others NSUN2 products on genomics-online (e.g. as negative or positive controls)
Alternative Name NSUN2 (NSUN2 Antibody Abstract)
Background Gene Symbol: NSUN2
Gene ID 54888
UniProt Q08J23
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against NSUN2 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-NOP2/Sun Domain Family, Member 2 (NSUN2) (C-Term) antibody (ABIN4890108) Western Blot: NSUN2 Antibody [NBP1-53052] - Hela cell lysate, concentration 0.2-1 ug/ml.
Did you look for something else?