QTRT1 antibody (Queuine tRNA-Ribosyltransferase 1)

Details for Product anti-QTRT1 Antibody No. ABIN4890110, Supplier: Log in to see
  • CG4947
  • Dmel\\CG4947
  • TGT
  • tgt
  • zgc:66378
  • FP3235
  • TGUT
  • 2610028E17Rik
  • Tgt
  • Tgut
  • tRNA-guanine transglycosylase
  • queuine tRNA-ribosyltransferase 1 S homeolog
  • queuine tRNA-ribosyltransferase 1
  • queuine tRNA-ribosyltransferase catalytic subunit 1
  • Tgt
  • Olsu_0732
  • Palpr_1298
  • Riean_1227
  • Calni_1240
  • Ftrac_0312
  • Ocepr_1541
  • Sulku_0977
  • Tmar_0854
  • Bache_2323
  • Nitsa_1291
  • Isop_1657
  • Despr_0021
  • Pedsa_1842
  • Corgl_1148
  • Mahau_0921
  • Theth_0831
  • qtrt1.S
  • qtrt1
  • QTRT1
  • Qtrt1
anti-Dog (Canine) QTRT1 antibody for Western Blotting
Human, Mouse (Murine)
This QTRT1 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to QTRT1(queuine tRNA-ribosyltransferase 1 (tRNA-guanine transglycosylase)) The peptide sequence was selected from the middle region of QTRT1. Peptide sequence KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTG
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others QTRT1 products on genomics-online (e.g. as negative or positive controls)
Alternative Name QTRT1 (QTRT1 Antibody Abstract)
Background Gene Symbol: QTRT1
Gene ID 81890
UniProt Q80VS3
Pathways Ribonucleoside Biosynthetic Process
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against QTRT1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Queuine tRNA-Ribosyltransferase 1 (QTRT1) antibody (ABIN4890110) Western Blot: QTRT1 Antibody [NBP1-53056] - MCF-7 whole cell lysates, concentration 0...
Did you look for something else?