HCFC1R1 antibody (Host Cell Factor C1 Regulator 1 (XPO1 Dependent))

Details for Product anti-HCFC1R1 Antibody No. ABIN4890119, Supplier: Log in to see
Antigen
  • HPIP
  • Hpip
  • host cell factor C1 regulator 1
  • host cell factor C1 regulator 1 (XPO1-dependent)
  • HCFC1R1
  • Hcfc1r1
Reactivity
Human
27
2
2
2
2
1
1
1
1
Host
Rabbit
27
Clonality
Polyclonal
Conjugate
This HCFC1R1 antibody is un-conjugated
3
3
3
2
2
2
Application
Western Blotting (WB)
22
19
19
4
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to HCFC1R1(host cell factor C1 regulator 1 (XPO1 dependent)) The peptide sequence was selected from the middle region of HCFC1R1. Peptide sequence LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others HCFC1R1 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name HCFC1R1 (HCFC1R1 Antibody Abstract)
Background Gene Symbol: HCFC1R1
Molecular Weight Theoretical MW: 15 kDa
Gene ID 54985
UniProt Q9NWW0
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against HCFC1R1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Host Cell Factor C1 Regulator 1 (XPO1 Dependent) (HCFC1R1) antibody (ABIN4890119) Western Blot: HCFC1R1 Antibody [NBP1-53070] - Human Spleen lysate, concentration 0.2-...
Did you look for something else?