ACTR1A antibody (ARP1 Actin-Related Protein 1 Homolog A, Centractin alpha (Yeast))

Details for Product anti-ACTR1A Antibody No. ABIN4890123, Supplier: Log in to see
  • ARP1
  • CTRN1
  • Arp1
  • alpha-Arp1
  • arp1
  • centractin
  • ctrn1
  • ACTR1A
  • ARP1 actin related protein 1 homolog A
  • ARP1 actin-related protein 1A, centractin alpha
  • ARP1 actin-related protein 1 homolog A, centractin alpha
  • ARP1 actin related protein 1 homolog A L homeolog
  • alpha-centractin
  • actin-2
  • ACTR1A
  • Actr1a
  • actr1a.L
  • actr1a
  • PTRG_02540
  • PAAG_06972
  • MCYG_01044
  • VDBG_00685
  • MGYG_00946
  • DICPUDRAFT_88548
  • PGTG_04034
  • Tsp_06409
anti-Humain ACTR1A antibody pour ELISA
This ACTR1A antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to ACTR1A(ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)) The peptide sequence was selected from the middle region of ACTR1A. Peptide sequence AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPE
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others ACTR1A products on genomics-online (e.g. as negative or positive controls)
Alternative Name ACTR1A (ACTR1A Antibody Abstract)
Background Gene Symbol: ACTR1A
Molecular Weight Theoretical MW: 41 kDa
Gene ID 10121
UniProt P61163
Pathways M Phase
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against ACTR1A and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-ARP1 Actin-Related Protein 1 Homolog A, Centractin alpha (Yeast) (ACTR1A) antibody (ABIN4890123) Western Blot: ACTR1A Antibody [NBP1-53075] - MCF-7 whole cell lysates, concentration ...
Did you look for something else?