Glycosyltransferase-Like Domain Containing 1 (GTDC1) (N-Term) antibody

Details for Product No. ABIN4890125, Supplier: Log in to see
Antigen
  • Hmat-Xa
  • mat-Xa
  • E330008O22Rik
  • zgc:110568
  • glycosyltransferase like domain containing 1
  • glycosyltransferase-like domain containing 1
  • glycosyltransferase like domain containing 1 S homeolog
  • GTDC1
  • Gtdc1
  • gtdc1.S
  • gtdc1
Epitope
N-Term
4
4
4
3
1
1
1
1
Reactivity
Human
44
24
22
4
4
4
3
3
2
2
2
1
1
1
Host
Rabbit
43
1
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
27
13
10
9
6
5
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to GTDC1(glycosyltransferase-like domain containing 1) The peptide sequence was selected from the N terminal of GTDC1. Peptide sequence CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK.
Purification Immunogen affinity purified
Antigen
Alternative Name GTDC1
Background Gene Symbol: GTDC1
Gene ID 79712
UniProt Q4AE62
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against GTDC1 and was validated on Western blot.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Glycosyltransferase-Like Domain Containing 1 (GTDC1) (N-Term) antibody (ABIN4890125) Western Blot: GTDC1 Antibody [NBP1-53078] - Jurkat cell lysate, concentration 0.2-1 u...
Did you look for something else?