Myozenin 1 (MYOZ1) antibody

Details for Product No. ABIN4890130, Supplier: Log in to see
  • LOC100009016
  • myoz1
  • MGC64407
  • zgc:92347
  • MGC89225
  • zgc:77785
  • MYOZ1
  • CS-2
  • FATZ
  • MYOZ
  • 2310001N11Rik
  • AV090278
  • Myoz
  • RGD1561064
  • myozenin 1
  • myozenin 1 L homeolog
  • myozenin 1b
  • myozenin 1a
  • MYOZ1
  • myoz1.L
  • myoz1b
  • myoz1
  • myoz1a
  • Myoz1
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to MYOZ1(myozenin 1) The peptide sequence was selected from the middle region of MYOZ1 (NP_067068). Peptide sequence TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY.
Purification Immunogen affinity purified
Alternative Name Myozenin 1 (MYOZ1 Antibody Abstract)
Background Gene Symbol: MYOZ1
Gene ID 58529
UniProt Q9NP98
Application Notes Western Blot 0.2-1 μg/mL

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Myozenin 1 (MYOZ1) antibody (ABIN4890130) Western Blot: Myozenin 1 Antibody [NBP1-53083] - NCI-H226 cell lysate, concentration ...
Did you look for something else?