WWP2 antibody (WW Domain Containing E3 Ubiquitin Protein Ligase 2)

Details for Product anti-WWP2 Antibody No. ABIN4890133
Antigen
Reactivity
Human
44
19
13
10
7
7
7
7
6
4
3
2
2
1
1
Host
Rabbit
39
5
Clonality
Polyclonal
Conjugate
This WWP2 antibody is un-conjugated
1
1
1
Application
Western Blotting (WB)
38
15
14
4
2
2
1
Options
Immunogen Synthetic peptides corresponding to WWP2(WW domain containing E3 ubiquitin protein ligase 2) The peptide sequence was selected from the middle region of WWP2. Peptide sequence SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP.
Purification Immunogen affinity purified
Antigen
Alternative Name WWP2 (WWP2 Antibody Abstract)
Background Gene Symbol: WWP2
Gene ID 11060
UniProt O00308
Pathways Negative Regulation of Transporter Activity
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against WWP2 and was validated on Western blot.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2) antibody (ABIN4890133) Western Blot: WWP2 Antibody [NBP1-53089] - Titration: 0.2-1 ug/ml, Positive Control: ...