WWP2 antibody (WW Domain Containing E3 Ubiquitin Protein Ligase 2)

Details for Product anti-WWP2 Antibody No. ABIN4890133
  • aip2
  • wwp2-like
  • id:ibd1121
  • wu:fo87e10
  • zgc:154036
  • AIP2
  • WWp2-like
  • 1300010O06Rik
  • AA690238
  • AW554328
  • WW domain containing E3 ubiquitin protein ligase 2
  • WWP2
  • wwp2
  • Wwp2
anti-Cow (Bovine) WWP2 antibody for Immunohistochemistry (Paraffin-embedded Sections)
This WWP2 antibody is un-conjugated
Western Blotting (WB)
Immunogen Synthetic peptides corresponding to WWP2(WW domain containing E3 ubiquitin protein ligase 2) The peptide sequence was selected from the middle region of WWP2. Peptide sequence SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others WWP2 products on genomics-online (e.g. as negative or positive controls)
Alternative Name WWP2 (WWP2 Antibody Abstract)
Background Gene Symbol: WWP2
Gene ID 11060
UniProt O00308
Pathways Negative Regulation of Transporter Activity
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against WWP2 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2) antibody (ABIN4890133) Western Blot: WWP2 Antibody [NBP1-53089] - Titration: 0.2-1 ug/ml, Positive Control: ...
Did you look for something else?