SPTAN1 antibody (Spectrin alpha Chain, Brain) (N-Term)

Details for Product anti-SPTAN1 Antibody No. ABIN4890135, Supplier: Log in to see
  • im:7157190
  • wu:fa20e05
  • wu:fb33g08
  • wu:fk32a10
  • zgc:112229
  • 2610027H02Rik
  • Spna-2
  • Spna2
  • EIEE5
  • NEAS
  • SPTA2
  • A2a
  • IPF
  • spectrin alpha, non-erythrocytic 1
  • spectrin, alpha, non-erythrocytic 1
  • SPTAN1
  • sptan1
  • Sptan1
anti-Chicken SPTAN1 antibody for Chromatin Immunoprecipitation
Human, Mouse (Murine), Rat (Rattus)
This SPTAN1 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunoprecipitation (IP), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to SPTAN1(spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)) The peptide sequence was selected from the N terminal of SPTAN1. Peptide sequence MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others SPTAN1 products on genomics-online (e.g. as negative or positive controls)
Alternative Name alpha Fodrin (SPTAN1 Antibody Abstract)
Background Gene Symbol: SPTAN1
Molecular Weight Theoretical MW: 272 kDa
Gene ID 6709
UniProt Q13813
Pathways Caspase Cascade in Apoptosis, Regulation of Actin Filament Polymerization
Application Notes Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against SPTAN1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody (ABIN4890135) Western Blot: Alpha Fodrin Antibody [NBP1-53093] - analysis of Alpha Fodrin in caco-2...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody (ABIN4890135) Immunohistochemistry-Paraffin: Alpha Fodrin Antibody [NBP1-53093] - Human Kidney tiss...
Immunohistochemistry (IHC) image for anti-Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody (ABIN4890135) Immunohistochemistry: Alpha Fodrin Antibody [NBP1-53093] - Immunohistochemistry with ...
Immunoprecipitation (IP) image for anti-Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody (ABIN4890135) Immunoprecipitation: Alpha Fodrin Antibody [NBP1-53093] - Titration: 2 ug/ml Positive...
Immunofluorescence (IF) image for anti-Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody (ABIN4890135) Immunocytochemistry/Immunofluorescence: Alpha Fodrin Antibody [NBP1-53093] - analysis...
Western Blotting (WB) image for anti-Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody (ABIN4890135) Western Blot: Alpha Fodrin Antibody [NBP1-53093] - NT-2 cell line, mouse brain, and r...
Did you look for something else?