Cytosolic Sulfotransferase 1C2/SULT1C2 (C-Term) antibody

Details for Product No. ABIN4890138, Supplier: Log in to see
Antigen
Epitope
C-Term
Reactivity
Human
2
Host
Rabbit
1
1
Clonality
Polyclonal
Application
Western Blotting (WB)
2
2
2
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to SULT1C2(sulfotransferase family, cytosolic, 1C, member 2) The peptide sequence was selected from the C terminal of SULT1C2 (NP_001047). Peptide sequence LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL.
Purification Immunogen affinity purified
Antigen
Background Gene Symbol: SULT1C2
Molecular Weight Theoretical MW: 35 kDa
Gene ID 6819
UniProt O00338
Application Notes Western Blot 0.2-1 μg/mLThe observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Cytosolic Sulfotransferase 1C2/SULT1C2 (C-Term) antibody (ABIN4890138) Western Blot: Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody [NBP1-53102] - Hela cel...
Did you look for something else?