EPH Receptor A5 antibody (EPHA5)

Details for Product anti-EPHA5 Antibody No. ABIN4890141, Supplier: Log in to see
  • CEK7
  • EHK-1
  • EHK1
  • EK7
  • HEK7
  • TYRO4
  • AI854630
  • AW125296
  • Cek7
  • Ehk1
  • Els1
  • Hek7
  • Rek7
  • bsk
  • Els1.
  • EPHA5
  • EPH receptor A5
  • Eph receptor A5
  • EPHA5
  • epha5
  • Epha5
anti-Human EPH Receptor A5 antibody for Immunohistochemistry (Paraffin-embedded Sections)
This EPH Receptor A5 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to EPHA5(EPH receptor A5) The peptide sequence was selected from the middle region of EPHA5. Peptide sequence SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others EPH Receptor A5 products on genomics-online (e.g. as negative or positive controls)
Alternative Name EphA5 (EPHA5 Antibody Abstract)
Background Gene Symbol: EPHA5
Molecular Weight Theoretical MW: 114 kDa
Gene ID 2044
UniProt P54756
Pathways RTK Signaling
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against EPHA5 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-EPH Receptor A5 (EPHA5) antibody (ABIN4890141) Western Blot: EphA5 Antibody [NBP1-53105] - Human Brain lysate, concentration 0.2-1 u...
Did you look for something else?