DTX2 antibody (Deltex Homolog 2 (Drosophila)) (C-Term)

Details for Product anti-DTX2 Antibody No. ABIN4890146, Supplier: Log in to see
  • RNF58
  • 2610524D08Rik
  • AA408415
  • AU022494
  • Deltex2
  • dtx2
  • deltex E3 ubiquitin ligase 2
  • probable E3 ubiquitin-protein ligase DTX2
  • deltex 2, E3 ubiquitin ligase
  • deltex 2, E3 ubiquitin ligase S homeolog
  • DTX2
  • Dtx2
  • LOC735784
  • LOC747633
  • dtx2
  • dtx2.S
anti-牛 DTX2 antibody for Western Blotting
This DTX2 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to DTX2(deltex homolog 2 (Drosophila)) The peptide sequence was selected from the C terminal of DTX2. Peptide sequence EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others DTX2 products on genomics-online (e.g. as negative or positive controls)
Alternative Name DTX2 (DTX2 Antibody Abstract)
Background Gene Symbol: DTX2
Gene ID 113878
UniProt Q6XM87
Pathways Notch Signaling
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against DTX2 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Deltex Homolog 2 (Drosophila) (DTX2) (C-Term) antibody (ABIN4890146) Western Blot: DTX2 Antibody [NBP1-53119] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Did you look for something else?