N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) antibody

Details for Product No. ABIN4890149, Supplier: Log in to see
  • NARG1L
  • 1300019C06Rik
  • Narg1l
  • narg1
  • narg1l
  • N(alpha)-acetyltransferase 16, NatA auxiliary subunit
  • N(alpha)-acetyltransferase 16, NatA auxiliary subunit L homeolog
  • N(alpha)-acetyltransferase 15, NatA auxiliary subunit S homeolog
  • NAA16
  • Naa16
  • naa16.L
  • naa15.S
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to NARG1L(NMDA receptor regulated 1-like) The peptide sequence was selected from the middle region of NARG1L. Peptide sequence ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA.
Purification Immunogen affinity purified
Alternative Name NARG1L (NAA16 Antibody Abstract)
Background Gene Symbol: NAA16
Gene ID 79612
UniProt B0QZ59
Application Notes Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against NARG1L and was validated on Western Blot and immunohistochemistry-P

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) antibody (ABIN4890149) Immunohistochemistry-Paraffin: NARG1L Antibody [NBP1-53124] - Human Muscle Tissue, Sk...
Western Blotting (WB) image for anti-N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) antibody (ABIN4890149) Western Blot: NARG1L Antibody [NBP1-53124] - HepG2 tissue lysate at a concentration o...
Did you look for something else?