GTPBP4 antibody (GTP Binding Protein 4) (C-Term)

Details for Product anti-GTPBP4 Antibody No. ABIN4890152, Supplier: Log in to see
  • CRFG
  • NGB
  • NOG1
  • 2610028C09Rik
  • Crfg
  • Gtpbp3
  • Nog1
  • fi28d07
  • zgc:55757
  • wu:fi28d07
  • xgb
  • GTP binding protein 4
  • GTP binding protein 4 L homeolog
  • GTPBP4
  • Gtpbp4
  • gtpbp4
  • CC1G_14285
  • gtpbp4.L
This GTPBP4 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to GTPBP4(GTP binding protein 4) The peptide sequence was selected from the C terminal of GTPBP4. Peptide sequence MVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others GTPBP4 products on genomics-online (e.g. as negative or positive controls)
Alternative Name GTPBP4 (GTPBP4 Antibody Abstract)
Background Gene Symbol: GTPBP4
Molecular Weight Theoretical MW: 74 kDa
Gene ID 23560
UniProt Q9BZE4
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against GTPBP4 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-GTP Binding Protein 4 (GTPBP4) (C-Term) antibody (ABIN4890152) Western Blot: GTPBP4 Antibody [NBP1-53130] - MCF-7 whole cell lysates, concentration ...
Did you look for something else?