Matrilin 2 (MATN2) antibody

Details for Product No. ABIN4890157, Supplier: Log in to see
  • matn2
  • MGC53027
  • MGC76198
  • MATN2
  • DKFZp469F2020
  • Crtm2
  • matrilin-2
  • matrilin 2 L homeolog
  • matrilin 2
  • matn2.L
  • matn2
  • MATN2
  • Matn2
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to MATN2(matrilin 2) The peptide sequence was selected from the middle region of MATN2. Peptide sequence AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED.
Purification Immunogen affinity purified
Alternative Name Matrilin-2 (MATN2 Antibody Abstract)
Background Gene Symbol: MATN2
Molecular Weight Theoretical MW: 102 kDa
Gene ID 4147
UniProt A8K106
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against MATN2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Matrilin 2 (MATN2) antibody (ABIN4890157) Western Blot: Matrilin-2 Antibody [NBP1-53142] - Human Lung lysate, concentration 0.2...
Did you look for something else?