Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1) (N-Term) antibody

Details for Product No. ABIN4890159, Supplier: Log in to see
  • ADR
  • ALDR1
  • ALR2
  • AR
  • ALR-P-I
  • Akr1b3
  • Akr1b4
  • Aldr1
  • Alr
  • akr1b7
  • zgc:86611
  • aldo-keto reductase family 1 member B
  • aldo-keto reductase family 1, member B1 (aldose reductase)
  • aldo-keto reductase family 1, member B1 (aldose reductase) S homeolog
  • AKR1B1
  • Akr1b1
  • akr1b1.S
  • akr1b1
anti-Human Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) antibody for Immunohistochemistry
Immunohistochemistry (IHC), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to AKR1B1(aldo-keto reductase family 1, member B1 (aldose reductase)) The peptide sequence was selected from the N terminal of AKR1B1. Peptide sequence ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN.
Purification Immunogen affinity purified
Alternative Name AKR1B1 (AKR1B1 Antibody Abstract)
Background Gene Symbol: AKR1B1
Molecular Weight Theoretical MW: 36 kDa
Gene ID 231
UniProt P15121
Pathways Metabolism of Steroid Hormones and Vitamin D, C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process
Application Notes Western Blot 0.2-1 μg/mL, ImmunohistochemistryThis is a rabbit polyclonal antibody against AKR1B1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1) (N-Term) antibody (ABIN4890159) Western Blot: AKR1B1 Antibody [NBP1-53144] - MCF-7 whole cell lysates, concentration ...
Western Blotting (WB) image for anti-Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1) (N-Term) antibody (ABIN4890159) Western Blot: AKR1B1 Antibody [NBP1-53144] - Reccomended Titration: 0.2 - 1 ug/ml ELI...
Immunohistochemistry (IHC) image for anti-Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1) (N-Term) antibody (ABIN4890159) Immunohistochemistry: AKR1B1 Antibody [NBP1-53144] - Formalin Fixed Paraffin Embedded...
Product cited in: Steuber, Heine, Podjarny, Klebe: "Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features." in: Journal of molecular biology, Vol. 379, Issue 5, pp. 991-1016, 2008 (PubMed).

Did you look for something else?