LASP1 antibody (LIM and SH3 Protein 1)

Details for Product anti-LASP1 Antibody No. ABIN4890161, Supplier: Log in to see
  • lasp1
  • MGC53336
  • LASP1
  • MGC89667
  • Lasp-1
  • MLN50
  • AA408629
  • Def-4
  • SH3P6
  • Tg(Col1a1-lacZ)1Ngma
  • fb92f05
  • wu:fb92f05
  • zgc:77542
  • lasp-1
  • mln50
  • LIM and SH3 protein 1
  • LIM and SH3 protein 1 L homeolog
  • lasp1
  • lasp1.L
  • LASP1
  • Lasp1
This LASP1 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to LASP1(LIM and SH3 protein 1) The peptide sequence was selected from the middle region of LASP1. Peptide sequence IKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others LASP1 products on genomics-online (e.g. as negative or positive controls)
Alternative Name LASP1 (LASP1 Antibody Abstract)
Background Gene Symbol: LASP1
Molecular Weight Theoretical MW: 30 kDa
Gene ID 3927
UniProt Q14847
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against LASP1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-LIM and SH3 Protein 1 (LASP1) antibody (ABIN4890161) Western Blot: LASP1 Antibody [NBP1-53148] - MCF-7 whole cell lysates, concentration 0...
Did you look for something else?