F-Box Protein 27 (FBXO27) antibody

Details for Product No. ABIN4890658, Supplier: Log in to see
Antigen
  • MGC145578
  • FBG5
  • Fbx27
  • E130008B10Rik
  • Gm161
  • F-box protein 27 S homeolog
  • F-box protein 27
  • fbxo27.S
  • fbxo27
  • FBXO27
  • Fbxo27
Reactivity
Human
32
20
20
2
2
1
1
1
1
Host
Rabbit
28
4
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
15
13
6
4
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to FBXO27(F-box protein 27) The peptide sequence was selected from the middle region of FBXO27. Peptide sequence LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG.
Purification Immunogen affinity purified
Antigen
Alternative Name FBXO27 (FBXO27 Antibody Abstract)
Background Gene Symbol: FBXO27
Molecular Weight Theoretical MW: 31 kDa
Gene ID 126433
UniProt Q8NI29
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against FBXO27 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-F-Box Protein 27 (FBXO27) antibody (ABIN4890658) Western Blot: FBXO27 Antibody [NBP1-55337] - Jurkat cell lysate, concentration 0.2-1 ...
Did you look for something else?