ATPAF1 antibody (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1) (N-Term)

Details for Product anti-ATPAF1 Antibody No. ABIN4891255, Supplier: Log in to see
Antigen
  • ATPAF1
  • T14G11.17
  • T14G11_17
  • ATP11
  • ATP11p
  • 6330547J17Rik
  • AI593252
  • id:ibd1136
  • si:dkey-171o17.2
  • zgc:110583
  • ATP synthase mitochondrial F1 complex assembly factor 1
  • ATP synthase F1 complex assembly factor
  • Atpaf1
  • ATPAF1
  • AT2G34050
  • atpaf1
Epitope
N-Term
4
2
2
1
1
1
1
1
Reactivity
Human
21
9
8
3
2
2
1
1
Host
Rabbit
20
1
Clonality
Polyclonal
Conjugate
This ATPAF1 antibody is un-conjugated
1
1
1
Application
Western Blotting (WB)
15
12
3
2
2
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to ATPAF1 (ATP synthase mitochondrial F1 complex assembly factor 1) The peptide sequence was selected from the N terminal of ATPAF1. Peptide sequence GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others ATPAF1 products on genomics-online (e.g. as negative or positive controls)
Alternative Name ATPAF1 (ATPAF1 Antibody Abstract)
Background Gene Symbol: ATPAF1
Gene ID 64756
UniProt A8MRA7
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against ATPAF1 and was validated on Western blot.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1) (N-Term) antibody (ABIN4891255) Western Blot: ATPAF1 Antibody [NBP1-56969] - MCF-7 whole cell lysates, concentration ...
Did you look for something else?