UPF3B antibody (UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast))

Details for Product anti-UPF3B Antibody No. ABIN4891407, Supplier: Log in to see
  • HUPF3B
  • MRXS14
  • RENT3B
  • UPF3X
  • 5730594O13Rik
  • AI317193
  • AW541158
  • RGD1560264
  • UPF3B, regulator of nonsense mediated mRNA decay
  • UPF3 regulator of nonsense transcripts homolog B (yeast)
  • UPF3B
  • Upf3b
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to UPF3B(UPF3 regulator of nonsense transcripts homolog B (yeast)) The peptide sequence was selected from the middle region of UPF3B (NP_542199) Peptide sequence KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA.
Purification Immunogen affinity purified
Alternative Name UPF3B (UPF3B Antibody Abstract)
Background Gene Symbol: UPF3B
Molecular Weight Theoretical MW: 58 kDa
Gene ID 65109
UniProt Q9BZI7
Application Notes Western Blot 0.2-1 μg/mLThe observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) antibody (ABIN4891407) Western Blot: UPF3B Antibody [NBP1-57233] - Titration: 0.2-1 ug/ml, Positive Control:...
Did you look for something else?