MAP4K2 antibody (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2) (N-Term)

Details for Product anti-MAP4K2 Antibody No. ABIN4891947, Supplier: Log in to see
  • BL44
  • GCK
  • RAB8IP
  • AI385662
  • Rab8ip
  • MAP4K2
  • dZ150L22.2
  • map4k2l
  • map4k2l-2
  • map4k3l
  • si:dz150l22.2
  • si:dz263j20.1
  • zgc:136670
  • mitogen-activated protein kinase kinase kinase kinase 2
  • mitogen activated protein kinase kinase kinase kinase 2
  • MAP4K2
  • Map4k2
  • LOC103346779
  • map4k2
This MAP4K2 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to MAP4K2(mitogen-activated protein kinase kinase kinase kinase 2) The peptide sequence was selected from the N terminal of MAP4K2. Peptide sequence TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR.
Purification Immunogen affinity purified
Alternative Name MAP4K2 (MAP4K2 Antibody Abstract)
Background Gene Symbol: MAP4K2
Molecular Weight Theoretical MW: 91 kDa
Gene ID 5871
UniProt Q12851
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against MAP4K2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Mitogen-Activated Protein Kinase Kinase Kinase Kinase 2 (MAP4K2) (N-Term) antibody (ABIN4891947) Western Blot: MAP4K2 Antibody [NBP1-58851] - Titration: 0.2-1 ug/ml, Positive Control...
Did you look for something else?