Oxysterol Binding Protein-Like 8 (OSBPL8) antibody

Details for Product No. ABIN4892540, Supplier: Log in to see
Antigen
  • RGD1561474
  • DKFZp469P0923
  • MST120
  • MSTP120
  • ORP8
  • OSBP10
  • AA536976
  • AA536995
  • C730029P18Rik
  • D330025H14Rik
  • ORP-8
  • oxysterol binding protein-like 8
  • oxysterol binding protein like 8
  • oxysterol binding protein like 8 L homeolog
  • oxysterol-binding protein-related protein 8
  • Osbpl8
  • OSBPL8
  • osbpl8.L
  • osbpl8
  • LOC100175952
Reactivity
Human
13
3
3
2
2
2
2
2
1
Host
Rabbit
8
5
Clonality
Polyclonal
Application
Western Blotting (WB)
12
3
3
2
2
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to OSBPL8(oxysterol binding protein-like 8) The peptide sequence was selected from the middle region of OSBPL8. Peptide sequence YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR.
Purification Immunogen affinity purified
Antigen
Alternative Name ORP8 (OSBPL8 Antibody Abstract)
Background Gene Symbol: OSBPL8
Molecular Weight Theoretical MW: 97 kDa
Gene ID 114882
UniProt Q68D75
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against OSBPL8 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Oxysterol Binding Protein-Like 8 (OSBPL8) antibody (ABIN4892540) Western Blot: ORP8 Antibody [NBP1-59815] - HT1080, Antibody Dilution: 1.0 ug/ml OSBPL...
Western Blotting (WB) image for anti-Oxysterol Binding Protein-Like 8 (OSBPL8) antibody (ABIN4892540) Western Blot: ORP8 Antibody [NBP1-59815] - OVCAR-3 cell lysate, concentration 0.2-1 u...
Western Blotting (WB) image for anti-Oxysterol Binding Protein-Like 8 (OSBPL8) antibody (ABIN4892540) Western Blot: ORP8 Antibody [NBP1-59815] - OVCAR-3, Antibody Dilution: 1.0 ug/ml OSBP...
Did you look for something else?