IL11RA antibody (Interleukin 11 Receptor, alpha) (Subunit alpha)

Details for Product anti-IL11RA Antibody No. ABIN4892757, Supplier: Log in to see
Antigen
  • CRSDA
  • fi26e06
  • il-11ra
  • wu:fi26e06
  • AI314697
  • GP130
  • Il-11ra
  • Il11ra
  • Il11ra2
  • NR1
  • interleukin 11 receptor subunit alpha
  • interleukin 11 receptor, alpha
  • interleukin 11 receptor subunit alpha 1
  • interleukin 11 receptor, alpha chain 1
  • IL11RA
  • il11ra
  • Il11ra1
  • Il11ra
Alternatives
anti-Human IL11RA antibody for Western Blotting
Epitope
Subunit alpha
5
5
5
4
3
3
3
3
2
2
2
1
1
1
1
1
Reactivity
Human
48
31
20
4
4
4
4
2
2
1
1
Host
Rabbit
56
7
Clonality
Polyclonal
Conjugate
This IL11RA antibody is un-conjugated
4
3
Application
Western Blotting (WB)
52
40
18
5
5
4
3
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to IL11RA(interleukin 11 receptor, alpha) The peptide sequence was selected from the middle region of IL11RA. Peptide sequence FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA.
Specificity This product is specific to Subunit or Isoform: alpha.
Purification Immunogen affinity purified
Alternative Name IL11RA (IL11RA Antibody Abstract)
Background Gene Symbol: IL11RA
Molecular Weight Theoretical MW: 43 kDa
Gene ID 3590
UniProt Q14626
Research Area Hematopoietic Progenitors, Cytokines, Innate Immunity, Cancer
Pathways JAK-STAT Signaling, Growth Factor Binding
Application Notes Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against IL11RA and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Interleukin 11 Receptor, alpha (IL11RA) (Subunit alpha) antibody (ABIN4892757) Western Blot: IL11RA Antibody [NBP1-62351] - Human Muscle lysate, concentration 0.2-1...
Product cited in: Winship, Van Sinderen, Rainczuk, Dimitriadis: "Therapeutically blocking Interleukin-11 Receptor-α enhances doxorubicin cytotoxicity in high grade type I endometrioid tumours." in: Oncotarget, Vol. 8, Issue 14, pp. 22716-22729, 2017 (PubMed). Method employed by authors: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (Sample species: Mouse (Murine)).

Did you look for something else?