Phosphatidylinositol Transfer Protein, Membrane-Associated 1 (PITPNM1) (N-Term) antibody

Details for Product No. ABIN4892952, Supplier: Log in to see
  • DRES9
  • Mpt-1
  • Nir-2
  • PITPnm 1
  • Pitpnm
  • R75447
  • Rd9
  • RdgB
  • RdgB1
  • NIR2
  • RDGB
  • RDGB1
  • RDGBA1
  • phosphatidylinositol transfer protein membrane associated 1
  • phosphatidylinositol transfer protein, membrane-associated 1
  • Pitpnm1
Human, Mouse (Murine)
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to PITPNM1 (phosphatidylinositol transfer protein, membrane-associated 1) The peptide sequence was selected from the N terminal of PITPNM1. Peptide sequence PDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSA
Purification Immunogen affinity purified
Alternative Name NIR2 (PITPNM1 Antibody Abstract)
Background Gene Symbol: PITPNM1
Molecular Weight Theoretical MW: 135 kDa
Gene ID 9600
UniProt O35954
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against PITPNM1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Phosphatidylinositol Transfer Protein, Membrane-Associated 1 (PITPNM1) (N-Term) antibody (ABIN4892952) Western Blot: NIR2 Antibody [NBP1-69043] - Human Heart lysate, concentration 0.2-1 ug...
Product cited in: Aryal, Rao: "Deficiency in Cardiolipin Reduces Doxorubicin-Induced Oxidative Stress and Mitochondrial Damage in Human B-Lymphocytes." in: PLoS ONE, Vol. 11, Issue 7, pp. e0158376, 2016 (PubMed). (Sample species: Mouse (Murine)). Further details: Western Blotting

Sclip, Bacaj, Giam, Südhof: "Extended Synaptotagmin (ESyt) Triple Knock-Out Mice Are Viable and Fertile without Obvious Endoplasmic Reticulum Dysfunction." in: PLoS ONE, Vol. 11, Issue 6, pp. e0158295, 2016 (PubMed).

Did you look for something else?