Histone Deacetylase 6 (HDAC6) (N-Term) antibody

Details for Product No. ABIN4892995
Antigen
  • HD6
  • Hd6
  • Hdac5
  • Sfc6
  • mHDA2
  • CG6170
  • DHDAC2
  • DmHDAC2
  • Dmel\\CG6170
  • HDAC
  • HDAC2
  • dHDAC2
  • dHDAC6
  • dmHDA404
  • hdac6
  • MGC53140
  • wu:fc31d02
  • dsim_GLEANR_17355
  • DsimGD17207
  • GD17207
  • HDAC6
  • ATHDA6
  • AXE1
  • HISTONE DEACETYLASE 6
  • MDC12.7
  • MDC12_7
  • RNA-MEDIATED TRANSCRIPTIONAL SILENCING 1
  • RPD3B
  • RTS1
  • SIL1
  • histone deacetylase 6
  • histone deacetylase 6
  • Histone deacetylase 6
  • histone deacetylase 6 L homeolog
  • GD17207 gene product from transcript GD17207-RB
  • Histone DeAcetylase
  • HDAC6
  • Hdac6
  • hdac6.L
  • hdac6
  • Dsim\HDAC6
  • PTRG_03035
  • HDA6
  • hda-6
Epitope
N-Term
37
30
27
6
5
5
4
4
3
3
3
3
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine)
260
135
69
20
6
6
3
3
3
3
1
1
Host
Rabbit
233
38
1
Clonality
Polyclonal
Conjugate
Un-conjugated
11
6
5
5
5
5
5
5
4
3
3
3
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
201
138
90
74
41
26
22
18
17
14
8
5
2
2
1
Options
Immunogen Synthetic peptides corresponding to Hdac6 (histone deacetylase 6) The peptide sequence was selected from the N terminal of Hdac6. Peptide sequence RQRKSRHNPQSPLQDSSATLKRGGKKGAVPHSSPNLAEVKKKGKMKKLSQ.
Purification Immunogen affinity purified
Antigen
Alternative Name HDAC6 (HDAC6 Antibody Abstract)
Background Gene Symbol: HDAC6
Molecular Weight Theoretical MW: 125 kDa
Gene ID 10013
Pathways Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
Application Notes Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against Hdac6 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-Histone Deacetylase 6 (HDAC6) (N-Term) antibody (ABIN4892995) Western Blot: HDAC6 Antibody [NBP1-69127] - WB Suggested Anti-Hdac6 Antibody Titratio...
Image no. 2 for anti-Histone Deacetylase 6 (HDAC6) (N-Term) antibody (ABIN4892995) Immunohistochemistry: HDAC6 Antibody [NBP1-69127] - Human Adult heart Observed Staini...
Image no. 3 for anti-Histone Deacetylase 6 (HDAC6) (N-Term) antibody (ABIN4892995) Immunocytochemistry/Immunofluorescence: HDAC6 Antibody [NBP1-69127] - Human Pineal Ti...
Image no. 4 for anti-Histone Deacetylase 6 (HDAC6) (N-Term) antibody (ABIN4892995) Immunohistochemistry-Paraffin: HDAC6 Antibody [NBP1-69127] - Human testis tissue at a...
Product cited in: Menden, Xia, Mabry, Noel-MacDonnell, Rajasingh, Ye, Sampath: "Histone deacetylase 6 regulates endothelial MyD88-dependent canonical TLR signaling, lung inflammation, and alveolar remodeling in the developing lung." in: American journal of physiology. Lung cellular and molecular physiology, Vol. 317, Issue 3, pp. L332-L346, 2019 (PubMed).

Did you look for something else?