Methyltransferase Like 4 (METTL4) (C-Term) antibody

Details for Product No. ABIN4893735, Supplier: Log in to see
  • HsT661
  • 2410198H06Rik
  • A730091E08Rik
  • AV296509
  • RGD1306451
  • methyltransferase like 4
  • METTL4
  • Mettl4
Rat (Rattus)
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptide directed towards the C terminal of human Mettl4The immunogen for this antibody is Mettl4. Peptide sequence SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS.
Purification Immunogen affinity purified
Alternative Name METTL4 (METTL4 Antibody Abstract)
Background Gene Symbol: METTL4
Gene ID 64863
NCBI Accession NP_001178743
Application Notes Western Blot 1:1000This is a rabbit polyclonal antibody against Mettl4 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Methyltransferase Like 4 (METTL4) (C-Term) antibody (ABIN4893735) Western Blot: METTL4 Antibody [NBP1-79301] - Rat Liver lysate, concentration 0.2-1 ug...
Did you look for something else?