ARHGAP20 antibody (rho GTPase Activating Protein 20)

Details for Product anti-ARHGAP20 Antibody No. ABIN4894053, Supplier: Log in to see
Antigen
  • ARHGAP20
  • rarhogap
  • MGC145445
  • fk54b10
  • wu:fk54b10
  • RARHOGAP
  • RARhoGAP
  • 6530403F17Rik
  • A530023E23Rik
  • mKIAA1391
  • Rho GTPase activating protein 20
  • ARHGAP20
  • arhgap20
  • Arhgap20
Reactivity
Human
44
27
22
3
3
3
2
2
2
1
1
Host
Rabbit
41
3
Clonality
Polyclonal
Conjugate
This ARHGAP20 antibody is un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
29
13
11
9
9
2
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptide directed towards the middle region of human ARHGAP20The immunogen for this antibody is ARHGAP20. Peptide sequence YSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQAQRK.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others ARHGAP20 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name ARHGAP20 (ARHGAP20 Antibody Abstract)
Background Gene Symbol: ARHGAP20
Molecular Weight Theoretical MW: 132 kDa
Gene ID 57569
NCBI Accession NP_065860
Application Notes Western Blot 1:1000This is a rabbit polyclonal antibody against ARHGAP20 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-rho GTPase Activating Protein 20 (ARHGAP20) antibody (ABIN4894053) Western Blot: ARHGAP20 Antibody [NBP1-79675] - Titration: 0.2-1 ug/ml, Positive Contr...
Did you look for something else?