Zinc Finger Protein 564 (ZNF564) (C-Term) antibody

Details for Product No. ABIN4894524, Supplier: Log in to see
  • zinc finger protein 564
  • ZNF564
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptide directed towards the C terminal of human ZNF564. Peptide sequence GEKPYECKQCGKTFSYSSSFQRHERAHNGDKPYVKNVGKLSFITQPSNTC.
Purification Immunogen affinity purified
Alternative Name ZNF564 (ZNF564 Antibody Abstract)
Background Gene Symbol: ZNF564
Gene ID 163050
NCBI Accession NP_659413
Application Notes Western Blot 1:1000This is a rabbit polyclonal antibody against ZNF564 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Zinc Finger Protein 564 (ZNF564) (C-Term) antibody (ABIN4894524) Western Blot: ZNF564 Antibody [NBP1-80396] - Jurkat cell lysate, concentration 0.2-1 ...
Did you look for something else?