Ataxin 2 antibody

Catalog No. ABIN4950268

Product Details anti-Ataxin 2 Antibody

Target: Ataxin 2 (ATXN2)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ataxin 2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL of human ATXN2 were used as the immunogen for the ATX2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ATX2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,Immunocytochemistry : 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ATX2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Ataxin 2

Target: Ataxin 2 (ATXN2)

Alternative Name: Ataxin-2 / ATXN2 (ATXN2 Products)

Synonyms: ASL13 antibody, ATX2 antibody, SCA2 antibody, TNRC13 antibody, 9630045M23Rik antibody, AW544490 antibody, Sca2 antibody, ATXN2 antibody, MGC115230 antibody, ataxin 2 antibody, ataxin 2 L homeolog antibody, ATXN2 antibody, Atxn2 antibody, atxn2.L antibody

Background: Ataxin-2, or ATX2, protein is encoded by the ATXN2 gene and contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.

UniProt: Q99700

Pathways: Ribonucleoprotein Complex Subunit Organization