B3GNT8 antibody

Catalog No. ABIN4950282

Product Details anti-B3GNT8 Antibody

Target: B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 8 (B3GNT8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B3GNT8 antibody is un-conjugated

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC of human B3GNT8 were used as the immunogen for the B3GNT8 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the B3GNT8 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the B3GNT8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for B3GNT8

Target: B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 8 (B3GNT8))

Alternative Name: B3GNT8 (B3GNT8 Products)

Synonyms: B3GALT7 antibody, BGALT15 antibody, beta3Gn-T8 antibody, B3galt7 antibody, B7galt7 antibody, BC025206 antibody, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 antibody, B3GNT8 antibody, B3gnt8 antibody

Background: B3GNT8 is a galactosyltransferase involved in the synthesis of poly-N-acetyllactosamine (polyLacNAc), a linear chain of repeating LacNAc units made up of galactose (Gal) and N-acetylglucosamine (GlcNAc) with the structure (Gal-beta-1-4-GlcNAc-beta-1-3)n. By genomic sequence analysis, the B3GNT8 gene is mapped to chromosome 19q13.2. It was showed that a soluble form of B3GNT8 overexpressed by transfected HEK293 cells selectively transferred GlcNAc from UDP-GlcNAc to the nonreducing terminus of Gal-beta-1-4-GlcNAc-alpha-p-nitrophenyl phosphate and to lactoside-alpha-benzoyl. It did not utilize keratan sulfates or polylactosamine oligosaccharide as substrate. B3GNT8 activity required Mn(2+) and showed less efficiency with Co(2+). The pH optimum was between 7 and 7.5. B3GNT8 also transferred GlcNAc onto alpha-1-acid glycoprotein and ovomucoid, which possess tetraantennary complex type and pentaantennary complex type N-glycans. With a tetraantennary N-glycan substrate, B3GNT8 appeared to prefer the beta-1-2 branch over the beta-1-6 branch. When overexpressed in HCT15 human colon cancer cells, B3GNT8 increased cell surface expression of both polyLacNAc and beta-1-6-branched N-glycans.

UniProt: Q7Z7M8