c-Rel antibody

Catalog No. ABIN4950367

Product Details anti-c-Rel Antibody

Target: c-Rel (REL proto-oncogene (c-Rel))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This c-Rel antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD of mouse c-Rel were used as the immunogen for the c-Rel antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the c-Rel antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the c-Rel antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for c-Rel

Target: c-Rel (REL proto-oncogene (c-Rel))

Alternative Name: c-Rel / REL (c-Rel Products)

Synonyms: C-Rel antibody, c-Rel antibody, NFkB antibody, c-rel antibody, zgc:100833 antibody, Xrel2 antibody, Xrel3 antibody, rel antibody, rel-A antibody, rel2 antibody, rel3 antibody, v-rel antibody, xrel antibody, REL proto-oncogene, NF-kB subunit antibody, reticuloendotheliosis oncogene antibody, RELA proto-oncogene, NF-kB subunit antibody, v-rel avian reticuloendotheliosis viral oncogene homolog antibody, v-rel avian reticuloendotheliosis viral oncogene homolog L homeolog antibody, ribonuclease A family member 2 pseudogene antibody, REL antibody, Rel antibody, Rela antibody, rel antibody, rel.L antibody, ECRP antibody

Background: The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-kB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin's lymphoma.

UniProt: P15307